Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Candida albicans Palmitoyltransferase PFA3 (PFA3)

This Recombinant Candida albicans Palmitoyltransferase PFA3 (PFA3) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

Palmitoyltransferase PFA3, EC= 2.3.1.-, Protein fatty acyltransferase 3

UniProt

Q5ADN9

Expression Region

1-386

Origin

Candida albicans (strain SC5314 / ATCC MYA-2876) (Yeast)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAILYKYPMATNNNNNNGNPILRSLETSCCFLATLFPKVFCTLVLTWSLYVLLFIIPNY IKSSLNSTILNIIGITLYVLCIISYYKIILIGPGSPLDYPELRINDLNRMINENPYNNNN NDEEPGDLPPESMIIHTMKVNGNQGYRYCTKCSVWKPDRSHHCSSSGKCILKMDHYCPWF STCIGFHNYKFFIQFLSYVAIYCWFLFIISGKILYNFITEGLFEDEILSLNLVAVLILSF AFAIAVSVFAMFSIYLCCKNLTTIEFQEKRWNYRGQANDERFNYEFDNNGKRKKINTNIF DLGIMENWKSVMGPNWITWILPITVTVTANTKSMISQDEFNNGVNFKVNEEIYAKYLHNA ELQQQLNQQLSSYKDRLRRERQANIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL
BNC400204-500 1x 500 µL

Complement C4d (C4D204), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF405S conjugate, 0.1mg/mL
BNC040152-100 1x 100 µL

CD11c (HC1/1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL
BNC741620-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/1620), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bax (2D2), CF568 conjugate, 0.1mg/mL
BNC680004-100 1x 100 µL

Bax (2D2), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL
BNC472711-100 1x 100 µL

Carboxypeptidase A1 / CPA1 (Pancreatic Cancer Marker) (CPA1/2711), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL
BNC880820-500 1x 500 µL

Caldesmon, HMW (h-Caldesmon) (CALD1/820), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details