Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum timopheevii ATP synthase subunit a (ATP6)

This Recombinant Triticum timopheevii ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P68526

Expression Region

1-386

Origin

Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal SHD Antibody [CoraFluor 1]
NBP2-98087CL1 0.1 mL

Rabbit Polyclonal SHD Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Stomacher BSTO-102
BSTO-102 1 Unit

Stomacher BSTO-102

Sign In for Pricing
View Details
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled
orb3143149-01 10 mg

FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled

Sign In for Pricing
View Details
FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled
orb3143149-02 50 mg

FA2[3]BG1 & FA2[6]BG1 glycan (G1B), 2-AA labelled

Sign In for Pricing
View Details
Lentiviral mouse Nlrp9b shRNA (UAS) - Lentiviral mouseNlrp9b shRNA (UAS, GFP) (25)
GTR15103316 1 Vial

Lentiviral mouse Nlrp9b shRNA (UAS) - Lentiviral mouseNlrp9b shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
CST2 (Cystatin SA, MGC71924) (APC)
MBS6169816-01 0.1 mL

CST2 (Cystatin SA, MGC71924) (APC)

Sign In for Pricing
View Details