Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Triticum timopheevii ATP synthase subunit a (ATP6)

This Recombinant Triticum timopheevii ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-386.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

P68526

Expression Region

1-386

Origin

Triticum timopheevii (Timopheev's wheat) (Triticum dicoccon var. timopheevii)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRFLSTDMKDRNMLFAAITTNQPIRSKCSRLPDLHDFFPTNISQNFAITPNLDITPTPER IAGVTIVLQIEEYLGQNESEQGAVNLARTVLGARHRNGETWQGILEDIRAGGGMDNFIQN LPGAYPETPLDQFAIIPIIDLHVGNFYLSFTNEVLYMLLTVVLVVFLFFVVTKKGGGKSV PNAWQSLVELIYDFVLNLVNEQIGGLSGNVKQKFFPRISVTFTFSLFRNPQGMIPFSFTV TSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRAL SLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAISQ AHVSTISICIYLNDATNLHQNESFHN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep
AP94454 50 µg

Recombinant Human NFIL3 Protein, N-His-SUMO & C-Strep

Sign In for Pricing
View Details
Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit
GTR10478000-01 48 Well

Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit

Sign In for Pricing
View Details
Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit
GTR10478000-02 96 Well

Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit

Sign In for Pricing
View Details
Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit
GTR10478000-03 192 Well

Guinea pig Superoxide Dismutase, Copper Chaperone ELISA Kit

Sign In for Pricing
View Details
TAMM41 Antibody
orb41096-01 50 μL

TAMM41 Antibody

Sign In for Pricing
View Details
TAMM41 Antibody
orb41096-02 100 µL

TAMM41 Antibody

Sign In for Pricing
View Details