Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P03139

Expression Region

2-389

Origin

Hepatitis B virus genotype D subtype adw (isolate United Kingdom/adyw/1979) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPLSPPLRTTHPQAMHWNSTTFHQTLQ DPRVRGLYFPAGGSSSGTVNPVPTTTSPISSIFSRIGDPALNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTPAQGISMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPIVWLSVIWMM WYWGPSLYSILSPFLPLLPIFFCLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTF3C2 (NM_001521) Human Recombinant Protein
E45H40951M5 20 µg

GTF3C2 (NM_001521) Human Recombinant Protein

Sign In for Pricing
View Details
Human CD300C ELISA Kit
orb526895 96 Tests

Human CD300C ELISA Kit

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
EKN48667-01 48 Tests

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
EKN48667-02 96 Tests

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details
Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit
EKN48667-03 5x 96 Tests

Mouse Syntaxin 1A, Brain (STX1A) ELISA Kit

Sign In for Pricing
View Details
INAVA Rabbit Polyclonal Antibody
E10G09400 100 µL

INAVA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details