Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A2 subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A2 subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P03142

Expression Region

2-389

Origin

Hepatitis B virus genotype A2 subtype adw (isolate Japan/Nishioka/1983) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFLPDHQLDPAFGANSTNPDWDFNPIKDHWPAANQVGVGAFGPGLTPPHG GILGWSPQAQGILTTVSTIPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTALHQALQ DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTIMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMM WYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Arylsulfatase A (ARSA) ELISA Kit
abx363732 96 Well

Rabbit Arylsulfatase A (ARSA) ELISA Kit

Sign In for Pricing
View Details
RAB27A (NM_183234) Human Tagged Lenti ORF Clone
RC217900L2 10 µg

RAB27A (NM_183234) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CF®488A Donkey Anti-Human IgG (H+L), Highly Cross-Adsorbed
#20074-1mg 1x 1 mg

CF®488A Donkey Anti-Human IgG (H+L), Highly Cross-Adsorbed

Sign In for Pricing
View Details
ZBTB38 Antibody
orb2674567-01 50 µL

ZBTB38 Antibody

Sign In for Pricing
View Details
ZBTB38 Antibody
orb2674567-02 100 µL

ZBTB38 Antibody

Sign In for Pricing
View Details
ZBTB38 Antibody
orb2674567-03 200 µL

ZBTB38 Antibody

Sign In for Pricing
View Details