Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A2 subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A2 subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P03142

Expression Region

2-389

Origin

Hepatitis B virus genotype A2 subtype adw (isolate Japan/Nishioka/1983) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFLPDHQLDPAFGANSTNPDWDFNPIKDHWPAANQVGVGAFGPGLTPPHG GILGWSPQAQGILTTVSTIPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTALHQALQ DPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTGDPVTIMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCKTCTTPAQGNSKFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSAIWMM WYWGPSLYSIVSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit
MBS087887 Inquire

Chicken Proteolipid Protein 2, Colonic Epithelium Enriched ELISA Kit

Sign In for Pricing
View Details
3-deaza-3-me-dA 10 umol scale
26-6902-10 1 Each

3-deaza-3-me-dA 10 umol scale

Sign In for Pricing
View Details
Plant Programmed Cell Death Protein 1 (PDCD1) ELISA Kit
MBS9375165 Inquire

Plant Programmed Cell Death Protein 1 (PDCD1) ELISA Kit

Sign In for Pricing
View Details
NR2E3 siRNA (Human)
orb1861528-01 15 nmol

NR2E3 siRNA (Human)

Sign In for Pricing
View Details
NR2E3 siRNA (Human)
orb1861528-02 30 nmol

NR2E3 siRNA (Human)

Sign In for Pricing
View Details
Human NME9 qPCR Primer Pair
QH74061S 200 Tests

Human NME9 qPCR Primer Pair

Sign In for Pricing
View Details