Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

O92921

Expression Region

2-389

Origin

Hepatitis B virus genotype D (isolate Germany/1-91/1991) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPTPLSPPLRNTHPQAMQWNSTTFHQTLQ DPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNMENITSGLLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSVGPCRTCTTTVQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYRILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Fatty acid desaturase 3 (Fads3)
MBS7014496-01 0.02 mg

Recombinant Rat Fatty acid desaturase 3 (Fads3)

Sign In for Pricing
View Details
Recombinant Rat Fatty acid desaturase 3 (Fads3)
MBS7014496-02 0.1 mg

Recombinant Rat Fatty acid desaturase 3 (Fads3)

Sign In for Pricing
View Details
Recombinant Rat Fatty acid desaturase 3 (Fads3)
MBS7014496-03 5x 0.1 mg

Recombinant Rat Fatty acid desaturase 3 (Fads3)

Sign In for Pricing
View Details
AQC 50mg
A24583-50 50 mg

AQC 50mg

Sign In for Pricing
View Details
MMP-2, ID (72kD Type IV Collagenase, 72kD Gelatinase, Gelatinase A, Matrix Metalloproteinase-2, TBE-1, MMP2, CLG4A) discontinued
M2420-59A 250 µL

MMP-2, ID (72kD Type IV Collagenase, 72kD Gelatinase, Gelatinase A, Matrix Metalloproteinase-2, TBE-1, MMP2, CLG4A) discontinued

Sign In for Pricing
View Details
PDCD11 sgRNA CRISPR Lentivector (Human) (Target 2)
K1616703 1.0 µg DNA

PDCD11 sgRNA CRISPR Lentivector (Human) (Target 2)

Sign In for Pricing
View Details