Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orangutan hepatitis B virus Large envelope protein (S)

This Recombinant Orangutan hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q77NU1

Expression Region

2-389

Origin

Orangutan hepatitis B virus (isolate Somad) (HBVoru)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSVTNPLGFFPEHQLDPLFRANTNNPDWDFNPNKDTWPEATKVGVGAFGPGFTPPHG GLLGWSPQAQGVTTILPAVPPPASTNRQSGRRPTPISPPLRDTHPQAMQWNSTVFHQALQ DPRVRGLYFPAGGSSSGTVSPVPTTASPISSTFLKTGDPALNMESISSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSLTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTTTTSVGPCRTCTISAPGTSLFPSCC CTKPSDGNCTCIPIPPSWAFAKFLWGWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMI WYWGPSLYNILSPFIPLLPIFFCLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (NM_000611) Human Recombinant Protein
TP318343L 1 mg

CD59 (NM_000611) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), Biotin conjugate, 0.1mg/mL
BNCB2172-500 1x 500 µL

Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) (rEGP40/1372), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Protein Lysate, Colon
CP565773 150 µg

Tissue Protein Lysate, Colon

Sign In for Pricing
View Details
CARMIL (CARMIL1) Rabbit Polyclonal Antibody
TA372175 100 µL

CARMIL (CARMIL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione Reductase (GSR) (C-term) Rabbit Polyclonal Antibody
AP51963PU-N 400 µL

Glutathione Reductase (GSR) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CF®640R-dUTP, Lyophilized Powder
#40007 1x 25 nmol

CF®640R-dUTP, Lyophilized Powder

Sign In for Pricing
View Details