Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orangutan hepatitis B virus Large envelope protein (S)

This Recombinant Orangutan hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q77NU1

Expression Region

2-389

Origin

Orangutan hepatitis B virus (isolate Somad) (HBVoru)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSVTNPLGFFPEHQLDPLFRANTNNPDWDFNPNKDTWPEATKVGVGAFGPGFTPPHG GLLGWSPQAQGVTTILPAVPPPASTNRQSGRRPTPISPPLRDTHPQAMQWNSTVFHQALQ DPRVRGLYFPAGGSSSGTVSPVPTTASPISSTFLKTGDPALNMESISSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCPGQNSQSLTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYRGMLPVCPLLPGTTTTSVGPCRTCTISAPGTSLFPSCC CTKPSDGNCTCIPIPPSWAFAKFLWGWASVRFSWLNLLVPFVQWFAGLSPTVWLSVIWMI WYWGPSLYNILSPFIPLLPIFFCLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GAD65 Recombinant Chimeric Antibody Antibody
HA610232 100 µg

GAD65 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
MAB21L4 (NM_001085437) Human Over-expression Lysate
LC421299 20 µg

MAB21L4 (NM_001085437) Human Over-expression Lysate

Sign In for Pricing
View Details
FOXM1 Recombinant Rabbit monoclonal Antibody
HA723260 100 µL

FOXM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mitofusin 2 Recombinant Rabbit Monoclonal Antibody [JE59-66]
HA720073 100 µL

Mitofusin 2 Recombinant Rabbit Monoclonal Antibody [JE59-66]

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) Human Gene Knockout Kit (CRISPR)
KN222862 1 Kit

Ataxin 1 (ATXN1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse PRF1 (Perforin 1) ELISA Kit
E-EL-M0890-01 24 Tests

Mouse PRF1 (Perforin 1) ELISA Kit

Sign In for Pricing
View Details