Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q81162

Expression Region

2-389

Origin

Hepatitis B virus genotype C subtype adr (isolate Japan/A4/1994) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHG GLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALL DPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCC CTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMM WYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Selenot (NM_001040396) Mouse Tagged ORF Clone
MG201303 10 µg

Selenot (NM_001040396) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Carbonic Anhydrase VIII (CPTC-CA8-2), 0.2mg/mL
BNUB2232-500 1x 500 µL

Carbonic Anhydrase VIII (CPTC-CA8-2), 0.2mg/mL

Sign In for Pricing
View Details
Benfuracarb, 90%
TRC-B136100-1G 1 g

Benfuracarb, 90%

Sign In for Pricing
View Details
Bax (2D2), CF740 conjugate, 0.1mg/mL
BNC740004-500 1x 500 µL

Bax (2D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cefminox Sodium Heptahydrate
TRC-C243100-5G 5 g

Cefminox Sodium Heptahydrate

Sign In for Pricing
View Details
TRITC Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-
R-5701-2 2 mg

TRITC Conjugated Datura stramonium Lectin (Jimson Weed) -DSA-

Sign In for Pricing
View Details