Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype adr Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q81162

Expression Region

2-389

Origin

Hepatitis B virus genotype C subtype adr (isolate Japan/A4/1994) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDQWPEANQVGAGAFGPGFTPPHG GLLGWSPQAQGILTTVPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQWNSTTFHQALL DPRVRGLYFPAGGSSSGTVNPVPTIVSPISSIFSRTGDPAPNMESTTSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGEAPTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQGTSMFPSCC CTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFAGLSPTVWLSVIWMM WYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD4 (T-Helper/Inducer Cell Marker) (RIV7), 0.2mg/mL
BNUB0362-100 1x 100 µL

CD4 (T-Helper/Inducer Cell Marker) (RIV7), 0.2mg/mL

Sign In for Pricing
View Details
HypoGel® 400 HMBA
SP400110150140.100G 100 g

HypoGel® 400 HMBA

Sign In for Pricing
View Details
Human ZNF526 activation kit by CRISPRa
GA114565 1 Kit

Human ZNF526 activation kit by CRISPRa

Sign In for Pricing
View Details
RIMKA Antibody
8C18431-AAT 50 µg

RIMKA Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS620031 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
Recombinant INTS10 Antibody
RC-6869-01 50 μL

Recombinant INTS10 Antibody

Sign In for Pricing
View Details