Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9QMI0

Expression Region

2-389

Origin

Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPLSPPLRDAHPQAMQWTSTTFHQALQ DPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDLAPNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMM WYWGPSLYSILSPFLPLLPIFFCLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ZNF800 activation kit by CRISPRa
GA116179 1 Kit

Human ZNF800 activation kit by CRISPRa

Sign In for Pricing
View Details
Rbpms Mouse Gene Knockout Kit (CRISPR)
KN514598 1 Kit

Rbpms Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAFG (NM_002359) Human Recombinant Protein
TP321486 20 µg

MAFG (NM_002359) Human Recombinant Protein

Sign In for Pricing
View Details
VPS45A (VPS45) (NM_007259) Human Recombinant Protein
TP306027 20 µg

VPS45A (VPS45) (NM_007259) Human Recombinant Protein

Sign In for Pricing
View Details
N-Acetyl Serotonine O-Sulfate Ester Triethylammonium Salt
TRC-A188365-5MG 5 mg

N-Acetyl Serotonine O-Sulfate Ester Triethylammonium Salt

Sign In for Pricing
View Details