Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype D subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q9QMI0

Expression Region

2-389

Origin

Hepatitis B virus genotype D subtype ayw (isolate Japan/JYW796/1988) (HBV-D)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHG GLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPLSPPLRDAHPQAMQWTSTTFHQALQ DPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIGDLAPNMENITSGFLGPLLVLQAG FFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTTAQGTSMYPSCC CTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPIVWLSVIWMM WYWGPSLYSILSPFLPLLPIFFCLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBXN10 antibody
FNab09215 100 µg

UBXN10 antibody

Sign In for Pricing
View Details
Carbonic anhydrase 2 Mouse Monoclonal Antibody [11A2]
EM1801-14 100 µL

Carbonic anhydrase 2 Mouse Monoclonal Antibody [11A2]

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-01 50 μL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-02 100 µL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Anti-Human IgG3 Antibody
KC-087-03 1 mL

Anti-Human IgG3 Antibody

Sign In for Pricing
View Details
Crystallin Alpha B (CPTC-CRYAB-1), CF568 conjugate, 0.1mg/mL
BNC682235-500 1x 500 µL

Crystallin Alpha B (CPTC-CRYAB-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details