Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chimpanzee hepatitis B virus Large envelope protein (S)

This Recombinant Chimpanzee hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P12911

Expression Region

2-389

Origin

Chimpanzee hepatitis B virus (isolate United Kingdom/LSH/1988) (HBVcpz)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GQNLSTSNPLGFFPEHQLDPAFKANTNNPDWDFNPKKDYWPEATKVGAGAFGPGFTPPHG GLLGLSPQAQGILTTLPANPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQALQ DPRVRGLYFPAGGSSSGTLNPVPNTASHISSVFSTTGDPAPNMENITSGFLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLR RFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSLIPSCC CTKPSDGNCTCIPIPSSWAFAKFLWEWASVRFSWLSLLAPFVQWFAGLSPTVWLLAIWMM WYWGPNLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human LAIR1/Leukocyte-associated immunoglobulin-like receptor 1 ELISA Kit
E1416Hu 96 Tests

Human LAIR1/Leukocyte-associated immunoglobulin-like receptor 1 ELISA Kit

Sign In for Pricing
View Details
Tmem70 (NM_027415) Mouse Untagged Clone
MC200942 10 µg

Tmem70 (NM_027415) Mouse Untagged Clone

Sign In for Pricing
View Details
Phospho-HER4 (Tyr1162) Rabbit Polyclonal Antibody (Cy5.5)
orb1044925 100 µL

Phospho-HER4 (Tyr1162) Rabbit Polyclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Preimplantation factor
orb2815555-01 50 mg

Preimplantation factor

Sign In for Pricing
View Details
Preimplantation factor
orb2815555-02 10 mg

Preimplantation factor

Sign In for Pricing
View Details
Recombinant Human PDLIM1 Protein, N-His
YHA03001 100 μg

Recombinant Human PDLIM1 Protein, N-His

Sign In for Pricing
View Details