Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B/C subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B/C subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P17399

Expression Region

2-389

Origin

Hepatitis B virus genotype B/C subtype adw (isolate Okinawa/pODW282/1998) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVGVGAFGPGFTPPHG GLLGWSPQAQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPGVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMI WFWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CHMP2A activation kit by CRISPRa
GA109079 1 Kit

Human CHMP2A activation kit by CRISPRa

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
BNC740009-500 1x 500 µL

MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF647 conjugate, 0.1mg/mL
BNC470969-100 1x 100 µL

Ep-CAM / CD326 (Cocktail PAN-EpCAM), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Human ESM‑1 Protein (His Tag)
PDMH100352-01 20 µg

Recombinant Human ESM‑1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ESM‑1 Protein (His Tag)
PDMH100352-02 100 µg

Recombinant Human ESM‑1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human ESM‑1 Protein (His Tag)
PDMH100352-03 500 µg

Recombinant Human ESM‑1 Protein (His Tag)

Sign In for Pricing
View Details