Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B/C subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B/C subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P17399

Expression Region

2-389

Origin

Hepatitis B virus genotype B/C subtype adw (isolate Okinawa/pODW282/1998) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPNKDNWPDANKVGVGAFGPGFTPPHG GLLGWSPQAQGLLTTVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPGVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMI WFWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pelitinib-d6
TRC-P218702-1MG 1 mg

Pelitinib-d6

Sign In for Pricing
View Details
Karyopherin beta 3 (IPO5) (NM_002271) Human Over-expression Lysate
LY419423 100 µg

Karyopherin beta 3 (IPO5) (NM_002271) Human Over-expression Lysate

Sign In for Pricing
View Details
Rat Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA Kit
RDR-REG1a-Ra-01 96 Tests

Rat Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA Kit

Sign In for Pricing
View Details
Rat Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA Kit
RDR-REG1a-Ra-02 48 Tests

Rat Regenerating Islet Derived Protein 1 Alpha (REG1a) ELISA Kit

Sign In for Pricing
View Details
STAT2 Rabbit Polyclonal Antibody
TA392619 100 µL

STAT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details