Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B2 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B2 Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P17397

Expression Region

2-389

Origin

Hepatitis B virus genotype B2 (isolate Indonesia/pIDW420/1988) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFKANSDNPDWDLNPHKDNWPDSNKVGVGAFGPGFTPPHG GLLGWSPQAQGILTTVPTAPPPASTNRQLGRKPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTTGDPVPNMENIASGLLGPLLVLQAG FFSLTKILTIPLSLDSWWTSLNFLGETPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WFWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMEM8C Adenovirus (Rat)
47108056 1.0 mL

TMEM8C Adenovirus (Rat)

Sign In for Pricing
View Details
Ght3 Antibody
orb854282 2 mg

Ght3 Antibody

Sign In for Pricing
View Details
TREM2 Rabbit pAb
APA3772-01 30 µL

TREM2 Rabbit pAb

Sign In for Pricing
View Details
TREM2 Rabbit pAb
APA3772-02 50 μL

TREM2 Rabbit pAb

Sign In for Pricing
View Details
TREM2 Rabbit pAb
APA3772-03 100 µL

TREM2 Rabbit pAb

Sign In for Pricing
View Details
SNX27 Protein Vector (Mouse) (pPM-C-His)
PV232513 500 ng

SNX27 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details