Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B1 subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B1 subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P17398

Expression Region

2-389

Origin

Hepatitis B virus genotype B1 subtype adw (isolate Japan/pJDW233/1988) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHG GLLGWSPQAQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRPS2 (NM_001039091) Human Over-expression Lysate
LC422014 20 µg

PRPS2 (NM_001039091) Human Over-expression Lysate

Sign In for Pricing
View Details
FITC Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063C-01 20 Tests

FITC Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
FITC Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063C-02 100 Tests

FITC Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
FITC Anti-Human CD37 Antibody[IPO-24]
E-AB-F1063C-03 2x 100 Tests

FITC Anti-Human CD37 Antibody[IPO-24]

Sign In for Pricing
View Details
High Sensitivity Human IL-2 (Interleukin 2) ELISA Kit
E-HSEL-H0002-01 24 Tests

High Sensitivity Human IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details
High Sensitivity Human IL-2 (Interleukin 2) ELISA Kit
E-HSEL-H0002-02 48 Tests

High Sensitivity Human IL-2 (Interleukin 2) ELISA Kit

Sign In for Pricing
View Details