Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B1 subtype adw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B1 subtype adw Large envelope protein (S) spans the amino acid sequence from region 2-389.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

P17398

Expression Region

2-389

Origin

Hepatitis B virus genotype B1 subtype adw (isolate Japan/pJDW233/1988) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVGAFGPGFTPPHG GLLGWSPQAQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQWNSTTFHQTLQ DPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTGDPVPNMENIASGLLGPLLVLQAG FFLLTKILTIPQSLDSWWTSLNFLGGTPVCLGQNSQSQISSHSPTCCPPICPGYRWMCLR RFIIFLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCC CTKPMDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLSPTVWLSVIWMM WYWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGMT Mouse Monoclonal Antibody [Clone ID: OTI10H9]
CF809132 100 µg

MGMT Mouse Monoclonal Antibody [Clone ID: OTI10H9]

Sign In for Pricing
View Details
CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF740 conjugate, 0.1mg/mL
BNC742418-100 1x 100 µL

CD5 (Mantle Cell Lymphoma Marker) (CD5/2418), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Biotin Anti-Human CD235 Antibody[HIR2]
E-AB-F1080B-01 25 µg

Biotin Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details
Biotin Anti-Human CD235 Antibody[HIR2]
E-AB-F1080B-02 100 µg

Biotin Anti-Human CD235 Antibody[HIR2]

Sign In for Pricing
View Details
Human CALHM1 activation kit by CRISPRa
GA116804 1 Kit

Human CALHM1 activation kit by CRISPRa

Sign In for Pricing
View Details
KLF8 Rabbit Polyclonal Antibody
TA377844 100 µL

KLF8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details