Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Woolly monkey hepatitis B virus Large envelope protein (S)

This Recombinant Woolly monkey hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-391.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

O71305

Expression Region

2-391

Origin

Woolly monkey hepatitis B virus (isolate Louisville) (WMHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLNQSTFNPLGFFPSHQLDPLFKANAGSADWDKNPNKDPWPQAHDTAVGAFGPGLVPPHG GLLGWSSQAQGLSVTVPDTPPPPSTNRDKGRKPTPATPPLRDTHPQAMTWNTSSFQSYLQ NPKVRGLYFPAGGSTSSIVNPVPTTASTTSSSFSTTGVPVSTMDITSSGFLGPLLALQAV FFLLTKILTMPQSLDSLWTSLNFLGGTPACPGLNSQSPTSSHSPTCCPPTCPGYRWMCLR RSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPTVTGTTTTTGPCRTCTPIVPGISSYPS CCCTKPTDGNCTCIPIPSSWAFAKFLWDWALARFSWLNSLLPFVQWFAGLSPTVWLLVIW MMWFWGPSLFSILSPFLPLLPLFFWLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhox7 Recombinant Protein (Mouse)
RP168146 100 µg

Rhox7 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
CARD6 Antibody
orb1424352 100 µL

CARD6 Antibody

Sign In for Pricing
View Details
NCOR2 Antibody - N-terminal region : HRP (ARP32464_T100-HRP)
ARP32464_T100-HRP 100 µL

NCOR2 Antibody - N-terminal region : HRP (ARP32464_T100-HRP)

Sign In for Pricing
View Details
WBP1 Human Over-expression Lysate
orb1368000 20 µg

WBP1 Human Over-expression Lysate

Sign In for Pricing
View Details
Anti-CD32 Antibody
E38A8516 100 µg -100 µL

Anti-CD32 Antibody

Sign In for Pricing
View Details
2-Propenoic acid, 2-methyl-, 3- (4-pyridinyl) propyl ester
OR1043034-01 100 mg

2-Propenoic acid, 2-methyl-, 3- (4-pyridinyl) propyl ester

Sign In for Pricing
View Details