Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Woolly monkey hepatitis B virus Large envelope protein (S)

This Recombinant Woolly monkey hepatitis B virus Large envelope protein (S) spans the amino acid sequence from region 2-391.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

O71305

Expression Region

2-391

Origin

Woolly monkey hepatitis B virus (isolate Louisville) (WMHBV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLNQSTFNPLGFFPSHQLDPLFKANAGSADWDKNPNKDPWPQAHDTAVGAFGPGLVPPHG GLLGWSSQAQGLSVTVPDTPPPPSTNRDKGRKPTPATPPLRDTHPQAMTWNTSSFQSYLQ NPKVRGLYFPAGGSTSSIVNPVPTTASTTSSSFSTTGVPVSTMDITSSGFLGPLLALQAV FFLLTKILTMPQSLDSLWTSLNFLGGTPACPGLNSQSPTSSHSPTCCPPTCPGYRWMCLR RSIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPTVTGTTTTTGPCRTCTPIVPGISSYPS CCCTKPTDGNCTCIPIPSSWAFAKFLWDWALARFSWLNSLLPFVQWFAGLSPTVWLLVIW MMWFWGPSLFSILSPFLPLLPLFFWLWAYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Actg1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6743502 1.0 µg DNA

Actg1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Gsdma2 Mouse qPCR Primer Pair (NM_029727)
MP205258 200 Reactions

Gsdma2 Mouse qPCR Primer Pair (NM_029727)

Sign In for Pricing
View Details
Β-Endorphin (1-27), human
M41090-01 100 mg

Β-Endorphin (1-27), human

Sign In for Pricing
View Details
Β-Endorphin (1-27), human
M41090-02 25 mg

Β-Endorphin (1-27), human

Sign In for Pricing
View Details
Β-Endorphin (1-27), human
M41090-03 50 mg

Β-Endorphin (1-27), human

Sign In for Pricing
View Details
Β-Endorphin (1-27), human
M41090-04 500 mg

Β-Endorphin (1-27), human

Sign In for Pricing
View Details