Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Pannexin-3 (Panx3)

This Recombinant Mouse Pannexin-3 (Panx3) spans the amino acid sequence from region 1-392.

Product Specifications

Product Name Alternative

Pannexin-3

UniProt

Q8CEG0

Expression Region

1-392

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLAHTAAEYMLSDALLPDRRGSRLKGLRLELPLDKMVKFITVGFPLLLMSLAFAQEFSS GSPISCFSPSNFSVRQAAYVDSSCWDSLAHHTQDKAGQYKVKSLWPHKALPYSLLALAVA MYLPVLLWQYVAVPSLSSDLLFIISELDKSYNRSIRLVQHMLQIRQSSSDPHVFWDELEK ARKERYFEFPLLERYLECKQRSHWLVATYLLRNALLLLFTSATYLYLGQFHLDVFFQDEF NCFIKTGLLHDETHVPELITCRLTSLSVFQIVSVSSAAIYTILVPVIIYNLTRLCRWDKG LLSIYEMLPAFDLLSRKMLGCPINDLNVILLFLRANISELISFSWLSVLSVLKDTTTQKH NIDTVVDFMTFVAGLEPSKPKHLTQHTYDEHA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-541-3p Vector
mh40813 500 ng

LentimiRa-hsa-miR-541-3p Vector

Sign In for Pricing
View Details
Versican/VCAN Rabbit Polyclonal Antibody (PE)
orb2621527 100 µg

Versican/VCAN Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Lentiviral mouse Lars shRNA (UAS) - Lentiviral mouse Lars shRNA (UAS, RFP) (25)
GTR15284231 1 Vial

Lentiviral mouse Lars shRNA (UAS) - Lentiviral mouse Lars shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
SHIP, CT (INPP5D, SH2-containing Inositol 5-phosphatase 1, SH2 Domain-containing Inositol Phosphatase 1, SHIP-1, Inositol Polyphosphate-5-phosphatase of 145kD, SIP-145, p150Ship Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, hp51CN, SHIP1) (MaxLight 405) discontinued
S1013-21E-ML405 100 µL

SHIP, CT (INPP5D, SH2-containing Inositol 5-phosphatase 1, SH2 Domain-containing Inositol Phosphatase 1, SHIP-1, Inositol Polyphosphate-5-phosphatase of 145kD, SIP-145, p150Ship Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 1, hp51CN, SHIP1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
B3GALNT2 Peptide
DF15917-BP 1 mg

B3GALNT2 Peptide

Sign In for Pricing
View Details
NT5C1A Antibody Blocking Peptide
orb1502276 500 µg

NT5C1A Antibody Blocking Peptide

Sign In for Pricing
View Details