Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Xenopus laevis Ceramide glucosyltransferase-A (ugcg-a)

This Recombinant Xenopus laevis Ceramide glucosyltransferase-A (ugcg-a) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Ceramide glucosyltransferase-A, XLCGT, EC= 2.4.1.80, UDP-glucose ceramide glucosyltransferase

UniProt

Q8AY29

Expression Region

1-394

Origin

Xenopus laevis (African clawed frog)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVLDLALQGLAIFGCVLFFVLWFMHFLSIVYTRLHLNKKISDKQPYSKLPGVSLLKPLK GVDPNLINNLETFFELDYPKFEILLCVQDLDDPAVDVCKKLLGKYPSDDAKLFIGGKKVG INPKINNLMPGYEVAKYDLIWICDSGIKVKPDTLTDMANQMTEKVGLVHGLPYVADRQGF AATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKEVLDQAGGLIAFAQYIAEDYFMA KAIADRGWKFSMATQVAMQNSGCYSISQFQSRMIRWAKLRINMLPATIICEPISECFVAS LIIGWAAHHIFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGPLNFSKLDYAVAWFIRESMT IYIFLSALWDPTISWRTGRFRLRCGGTAEEILDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL
BNC941429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL
BNC470676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF568 conjugate, 0.1mg/mL
BNC680164-500 1x 500 µL

CD28 (204.12), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL
BNC681081-100 1x 100 µL

CD45RO (190-2F2.5), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (DCS-6), CF594 conjugate, 0.1mg/mL
BNC940007-500 1x 500 µL

Cyclin D1 (DCS-6), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF740 conjugate, 0.1mg/mL
BNC742041-100 1x 100 µL

EpCAM / CD326 (Epithelial Marker) (EGP40/2041R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details