Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Ceramide glucosyltransferase (Ugcg)

This Recombinant Rat Ceramide glucosyltransferase (Ugcg) spans the amino acid sequence from region 1-394.

Product Specifications

Product Name Alternative

Ceramide glucosyltransferase, EC= 2.4.1.80, GLCT-1, Glucosylceramide synthase, GCS, UDP-glucose ceramide glucosyltransferase, UDP-glucose:N-acylsphingosine D-glucosyltransferas

UniProt

Q9R0E0

Expression Region

1-394

Origin

Rattus norvegicus (Rat)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MALLDLAQEGMALFGFVLFVVLWLMHFMSIIYTRLHLNKKATDKQPYSKLPGVSLLKPLK GVDPNLINNLETFFELDYPKYEVLLCVQDHDDPAIEVCKKLLGKYPNVDARLFIGGKKVG INPKINNLMPAYEVAKYDLIWICDSGIRVIPDTLTDMVNQMTERVGLVHGLPYVADRQGF AATLEQVYFGTSHPRSYISANVTGFKCVTGMSCLMRKDVLDQAGGLIAFAQYIAEDYFMA KAIADRGWKFSMSTQVAMQNSGSYSISQFQSRMIRWTKLRINMLPATIICEPISECFVAS LIIGWAAHHVFRWDIMVFFMCHCLAWFIFDYIQLRGVQGGTLCFSKLDYAVAWFIRESMT IYIFLSALWDPTISWRAGRYRLRCGGTAEEILDV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-500 1x 500 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF488A conjugate, 0.1mg/mL
BNC880176-500 1x 500 µL

CD5 (Cris-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF568 conjugate, 0.1mg/mL
BNC680152-100 1x 100 µL

CD11c (HC1/1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
BNC400026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL
BNC040795-100 1x 100 µL

CD56 / NCAM (NCAM1/795), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details