Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transmembrane protein 79 (TMEM79)

This Recombinant Bovine Transmembrane protein 79 (TMEM79) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Transmembrane protein 79

UniProt

Q5E9U3

Expression Region

1-395

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTEPETLALLEVKGPETLEKSPPQALVPNGRKLEGEDEVESLGAESSRVGSSAESPTARE GTEDGLDSTVSEAATLPWGTGPQPSAPFPDPPGWRNIEPEPPESEPPTKLEELPEDEASL LPEKAARAFVPIDLQCIERRPQEDLVVCCEASEGEHRRTFLPPRATHPEPPECKWAEAVV KPPGHSCGGCGGCGGREALRAVASVGAALILFPCLLYGAYAFLPFDAPRLPTMSSRLIYT LRCGVFATFPIVLGILVYGLSLLCFAALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLA VLSTYLPQDALKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYGLTFLPLLSMLLWNFYY MFVVEPERMLTASESRLDYPDHARSASDYRPRSRG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL
BNC880270-100 1x 100 µL

Fibronectin (HFN7.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
S100B (4C4.9 + S100B/1012), 0.2mg/mL
BNC041204-500 1x 500 µL

S100B (4C4.9 + S100B/1012), 0.2mg/mL

Sign In for Pricing
View Details
Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL
BNC470775-500 1x 500 µL

Pgp9.5 (UCHL-1) (UCHL1/775), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL
BNC742035-500 1x 500 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL
BNC941680-100 1x 100 µL

CD45RA (Leukocyte Marker) (K4B5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL
BNC400887-500 1x 500 µL

Cytochrome C (CTC05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details