Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Drosophila melanogaster Innexin inx3 (inx3)

This Recombinant Drosophila melanogaster Innexin inx3 (inx3) spans the amino acid sequence from region 1-395.

Product Specifications

Product Name Alternative

Innexin inx3, Innexin-3

UniProt

Q9VAS7

Expression Region

1-395

Origin

Drosophila melanogaster (Fruit fly)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAVFGMVSAVSGFIKIRYLLDKAVIDNMVFRCHYRITTAILFTCCIIVTANNLIGDPISC INDGAIPMHVINTFCWITYTYTIPGQQHRQIGTDVAGPGLGNEYGQEKRYHSYYQWVPFV LFFQGLMFYVPHWVWKNMEDGKIRMITDGLRGMVSVPDDYRRDRQDRILKYFVNSLNTHN GYSFAYFFCELLNFINVIVNIFMVDKFLGGAFMSYGTDVLKFSNMDQDKRFDPMIEIFPR LTKCTFHKFGPSGSVQKHDTLCVLALNILNEKIYIFLWFWFIILATISGVAVLYSLVVIM MPTTRETIIKRSYRSAQRKEIAGLVRRLEIGDFLILHFLSQNLSTRSYSDMLQQLCGLLG ASRTPSAPSTLEMNRISHPIYPPVETFGGGKETET

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL
BNC400003-500 1x 500 µL

CD45RO (UCHL-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL
BNC940017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL
BNC882375-500 1x 500 µL

Cytokeratin 14 (KRT14) (Squamous Cell Marker) (KRT14/2375), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL
BNC401729-500 1x 500 µL

MMP3 (Marker of Metastasis and Rheumatoid Arthritis) (1B4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL
BNC880818-100 1x 100 µL

CD45RA (PTPRC/818), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL
BNC940499-500 1x 500 µL

Cytokeratin 14 (LL002), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details