Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Gap junction gamma-1 protein (Gjc1)

This Recombinant Rat Gap junction gamma-1 protein (Gjc1) spans the amino acid sequence from region 1-396.

Product Specifications

Product Name Alternative

Gap junction gamma-1 protein, Connexin-45, Cx45, Gap junction alpha-7 protein

UniProt

A4GG66

Expression Region

1-396

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWSFLTRLLEEIHNHSTFVGKIWLTVLIVFRIVLTAVGGESIYYDEQSKFVCNTEQPGC ENVCYDAFAPLSHVRFWVFQIILVATPSVMYLGYAIHKIAKMEHGEADKKAARSKPYAMR WKQHRALEETEEDHEEDPMMYPEMELESEKENKEQSQPKPKHDGRRRIREDGLMKIYVLQ LLARTVFEVGFLIGQYFLYGFQVHPFYVCSRLPCPHKIDCFISRPTEKTIFLLIMYGVTG LCLLLNIWEMLHLGFGTIRDSLNSKRRELDDPGAYNYPFTWNTPSAPPGYNIAVKPDQIQ YTELSNAKIAYKQNKANIAQEQQYGSHEEHLPADLETLQREIRMAQERLDLAIQAYHHQN NPHGPREKKAKVGSKSGSNKSSISSKSGDGKTSVWI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL
BNC740253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF640R conjugate, 0.1mg/mL
BNC401052-100 1x 100 µL

CD3e (B-B12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL
BNC402123-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2123R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD64 (10.1), CF594 conjugate, 0.1mg/mL
BNC942846-100 1x 100 µL

CD64 (10.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SUMO-1 (SUMO1/1188), CF740 conjugate, 0.1mg/mL
BNC741188-100 1x 100 µL

SUMO-1 (SUMO1/1188), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (Macrophage Marker) (C68/2501), CF568 conjugate, 0.1mg/mL
BNC682501-500 1x 500 µL

CD68 (Macrophage Marker) (C68/2501), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details