Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yknZ (yknZ)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yknZ (yknZ) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yknZ

UniProt

O31712

Expression Region

1-397

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLENIRMALSSVLAHKMRSILTMLGIIIGVGSVIVVVAVGQGGEQMLKQSISGPGNTV ELYYMPSDEELASNPNAAAESTFTENDIKGLKGIEGIKQVVASTSESMKARYHEEETDAT VNGINDGYMNVNSLKIESGRTFTDNDFLAGNRVGIISQKMAKELFDKTSPLGEVVWINGQ PVEIIGVLKKVTGLLSFDLSEMYVPFNMMKSSFGTSDFSNVSLQVESADDIKSAGKEAAQ LVNDNHGTEDSYQVMNMEEIAAGIGKVTAIMTTIIGSIAGISLLVGGIGVMNIMLVSVTE RTREIGIRKSLGATRGQILTQFLIESVVLTLIGGLVGIGIGYGGAALVSAIAGWPSLISW QVVCGGVLFSMLIGVIFGMLPANKAAKLDPIEALRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Blocks, Colon: sigmoid
CB531056 1 Block

Frozen Tissue Blocks, Colon: sigmoid

Sign In for Pricing
View Details
CEBPB Antibody (Biotin)
orb46727-01 50 µg

CEBPB Antibody (Biotin)

Sign In for Pricing
View Details
CEBPB Antibody (Biotin)
orb46727-02 100 µg

CEBPB Antibody (Biotin)

Sign In for Pricing
View Details
Lentiviral mouse Gmppb shRNA (UAS) - Lentiviral mouse Gmppb shRNA (UAS) (100)
GTR15274158 1 Vial

Lentiviral mouse Gmppb shRNA (UAS) - Lentiviral mouse Gmppb shRNA (UAS) (100)

Sign In for Pricing
View Details
TMEM42-set siRNA/shRNA/RNAi Lentivector (Human)
47051091 4x 500 ng

TMEM42-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
SMYD2 monoclonal antibody
MB0147-01 50 µL

SMYD2 monoclonal antibody

Sign In for Pricing
View Details