Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yknZ (yknZ)

This Recombinant Bacillus subtilis Uncharacterized ABC transporter permease yknZ (yknZ) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Uncharacterized ABC transporter permease yknZ

UniProt

O31712

Expression Region

1-397

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLLENIRMALSSVLAHKMRSILTMLGIIIGVGSVIVVVAVGQGGEQMLKQSISGPGNTV ELYYMPSDEELASNPNAAAESTFTENDIKGLKGIEGIKQVVASTSESMKARYHEEETDAT VNGINDGYMNVNSLKIESGRTFTDNDFLAGNRVGIISQKMAKELFDKTSPLGEVVWINGQ PVEIIGVLKKVTGLLSFDLSEMYVPFNMMKSSFGTSDFSNVSLQVESADDIKSAGKEAAQ LVNDNHGTEDSYQVMNMEEIAAGIGKVTAIMTTIIGSIAGISLLVGGIGVMNIMLVSVTE RTREIGIRKSLGATRGQILTQFLIESVVLTLIGGLVGIGIGYGGAALVSAIAGWPSLISW QVVCGGVLFSMLIGVIFGMLPANKAAKLDPIEALRYE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r6 Protein Vector (Mouse) (pPB-C-His)
PV245814 500 ng

Vmn1r6 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
STFR P020-148x210-PE-CRD/1 AC Signs
824391 Card of 1 Pictogram(s)

STFR P020-148x210-PE-CRD/1 AC Signs

Sign In for Pricing
View Details
GGT1 CRISPRa sgRNA lentivector (set of three targets)(Human)
21475121 3x 1.0µg DNA

GGT1 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
TMEM14B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
46908061 1.0 µg DNA

TMEM14B Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
P114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: LBI6G8]
AMM21701VCF 100 µg

P114RhoGEF (ARHGEF18) Mouse Monoclonal Antibody [Clone ID: LBI6G8]

Sign In for Pricing
View Details
SHMT2 Protein Vector (Human) (pPB-N-His)
PV038014 500 ng

SHMT2 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details