Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0303 (AF_0303)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0303 (AF_0303) spans the amino acid sequence from region 1-397.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0303

UniProt

O29939

Expression Region

1-397

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFFVHFWVLSKPPFYSPNPEYPLHNYDTYLIYIKTALFYPLHKFSCFLCVLGSEVIRDQQ TVLLFGILIFSIFVALIAINRKNLELDRFAKWYGLLAFGVLTSLELVVTRSGDIANYFGP PEKIFFLPSYRHYPVVFLPLICVYSLSILYSTLSEENKGMIKTSANAFLKTMLFTLLICS FILNFFPGIKTGEHNFVSMSERSAILKTYDVQPDENLKKLHLNPEIVKKRAKKLEELRLS VFAENNILLYKPDEVKLLPKQSQLQGVLRIYNDVKFVLFQHPISNENRSIIVFNEIYIPQ NAKLRFSIALHPDVWDPEKGDGVTFEVYIRDEGFEELVFSKYIDPKHNPEERKWNDFEVD LSRYAGRNVTIIFSTLPGPNNDSRWDWAWWGEPRIEW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL
BNC040633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL
BNC680026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL
BNC470008-500 1x 500 µL

MAGE A1 (MA454), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL
BNC400225-500 1x 500 µL

Major Vault Protein (MVP) (1032), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL
BNC041231-500 1x 500 µL

Eosinophil Peroxidase (AHE-1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL
BNC040352-500 1x 500 µL

CD31 / PECAM-1 (158-2B3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details