Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q69603

Expression Region

2-399

Origin

Hepatitis B virus genotype E subtype ayw4 (isolate Kou) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNISTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMESITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYDILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nopchap1 Pre-designed siRNA Set A
SI109478A 1 Each

Mouse Nopchap1 Pre-designed siRNA Set A

Sign In for Pricing
View Details
Mouse Monoclonal NANP Antibody (OTI4D11) [PE/Atto594]
NBP2-72870PEATT594 0.1 mL

Mouse Monoclonal NANP Antibody (OTI4D11) [PE/Atto594]

Sign In for Pricing
View Details
AKAP8L (NM_001291478) Human Untagged Clone
SC336882 10 µg

AKAP8L (NM_001291478) Human Untagged Clone

Sign In for Pricing
View Details
Mouse Bactericidal/permeability increasing protein like 2 (BPIL2) ELISA Kit
GTR10344637 96 Well

Mouse Bactericidal/permeability increasing protein like 2 (BPIL2) ELISA Kit

Sign In for Pricing
View Details
Cis-5-Aza-4-oxo-oct-2-en-dioic acid
259746-01 500 mg

Cis-5-Aza-4-oxo-oct-2-en-dioic acid

Sign In for Pricing
View Details
Cis-5-Aza-4-oxo-oct-2-en-dioic acid
259746-02 1 g

Cis-5-Aza-4-oxo-oct-2-en-dioic acid

Sign In for Pricing
View Details