Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q69603

Expression Region

2-399

Origin

Hepatitis B virus genotype E subtype ayw4 (isolate Kou) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNISTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMESITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYDILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FN Protein, His Tag
E40KMPH1447 20 µg

Human FN Protein, His Tag

Sign In for Pricing
View Details
IL18BP antibody
38923-01 50 µL

IL18BP antibody

Sign In for Pricing
View Details
IL18BP antibody
38923-02 100 µL

IL18BP antibody

Sign In for Pricing
View Details
ERK1/2 Monoclonal Antibody, PerCP Conjugated
bsm-33337M-PerCP 100 µL

ERK1/2 Monoclonal Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Human Sirtuin 3 (SIRT3) ELISA Kit
abx255079 96 Well

Human Sirtuin 3 (SIRT3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Protopterus aethiopicus Keratin, type I cytoskeletal 13 (KRT13)
MBS1368452-01 0.02 mg (E-Coli)

Recombinant Protopterus aethiopicus Keratin, type I cytoskeletal 13 (KRT13)

Sign In for Pricing
View Details