Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E subtype ayw4 Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q69603

Expression Region

2-399

Origin

Hepatitis B virus genotype E subtype ayw4 (isolate Kou) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNISTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMESITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCMTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYDILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (APC)
MBS6168494-01 0.1 mL

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (APC)

Sign In for Pricing
View Details
ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (APC)
MBS6168494-02 5x 0.1 mL

ANGPTL1 (Angiopoietin-like 1, ANG3, ANGPT3, ARP1, AngY, KIAA0351, UNQ162, dJ595C2.2) (APC)

Sign In for Pricing
View Details
SNORD114-22 CRISPR Knock Out 293T Cell Line (Human)
44714141 1x 10^6 Cells / 1.0 mL

SNORD114-22 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody (Biotin)
abx272176-01 200 µL

Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody (Biotin)

Sign In for Pricing
View Details
Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody (Biotin)
abx272176-02 1 mL

Tumor Necrosis Factor Ligand Superfamily Member 13B / BAFF (TNFSF13B) Antibody (Biotin)

Sign In for Pricing
View Details
MCA-AVLQSGFR-Lys (Dnp) -Lys-NH2
P9731-0.1ml 20 mM x 0.1 mL

MCA-AVLQSGFR-Lys (Dnp) -Lys-NH2

Sign In for Pricing
View Details