Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q80IU6

Expression Region

2-399

Origin

Hepatitis B virus genotype E (isolate Cote d'Ivoire/ABI-129/2003) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMEGITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTSTGPCRTCTTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Lymphoid tissue
CS632044 5x 5 µm

Frozen Tissue Sections, Lymphoid tissue

Sign In for Pricing
View Details
Orotic Acid Monosodium Salt
TRC-O691515-5G 5 g

Orotic Acid Monosodium Salt

Sign In for Pricing
View Details
Rps12 Mouse Gene Knockout Kit (CRISPR)
KN515079 1 Kit

Rps12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Col17a1 Rabbit Polyclonal Antibody
AP23435PU-S 10 µg

Col17a1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PLCG1 (Ab-783) Antibody
8B0080-AAT 50 µg

PLCG1 (Ab-783) Antibody

Sign In for Pricing
View Details
Nlrp12 Mouse Gene Knockout Kit (CRISPR)
KN311043RB 1 Kit

Nlrp12 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details