Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q80IU3

Expression Region

2-399

Origin

Hepatitis B virus genotype E (isolate Cote d'Ivoire/ABI-212/2003) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRTGDPAPNMEGITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTITGPCRTCTTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNase II (DNASE2) (NM_001375) Human Recombinant Protein
TP309573M 100 µg

DNase II (DNASE2) (NM_001375) Human Recombinant Protein

Sign In for Pricing
View Details
C16orf88 (KNOP1) Human Gene Knockout Kit (CRISPR)
KN423350 1 Kit

C16orf88 (KNOP1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GPR12 Rabbit Polyclonal Antibody
TA368398 100 µL

GPR12 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant CITED2 Antibody
RC-15238-01 50 μL

Recombinant CITED2 Antibody

Sign In for Pricing
View Details
Recombinant CITED2 Antibody
RC-15238-02 100 µL

Recombinant CITED2 Antibody

Sign In for Pricing
View Details
Recombinant CITED2 Antibody
RC-15238-03 1 mL

Recombinant CITED2 Antibody

Sign In for Pricing
View Details