Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype E Large envelope protein (S)

This Recombinant Hepatitis B virus genotype E Large envelope protein (S) spans the amino acid sequence from region 2-399.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q80IU3

Expression Region

2-399

Origin

Hepatitis B virus genotype E (isolate Cote d'Ivoire/ABI-212/2003) (HBV-E)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GLSWTVPLEWGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGA FGPGFTPPHGGLLGWSPQAQGMLKTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQW NSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRTGDPAPNMEGITSGF LGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPTSNHSPTSCPPI CPGYRWMCLRRFIIFLFILLLCLIFLLVLLGYQGMLPVCPLIPGSSTTITGPCRTCTTLA QGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSP TVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant HMCES Antibody
RN-14596-01 50 μL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
Recombinant HMCES Antibody
RN-14596-02 100 µL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
Recombinant HMCES Antibody
RN-14596-03 1 mL

Recombinant HMCES Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-,  10nm
GP-8011-10 1 mL

Colloidal Gold Conjugated Calystega sepiem Lectin (Hedge Bindweed Rhizomes) -Calsepa-, 10nm

Sign In for Pricing
View Details
RealStar®RSV RT-PCR Kit 3.0 RUO
193003 96 Tests

RealStar®RSV RT-PCR Kit 3.0 RUO

Sign In for Pricing
View Details
Human CHST2 activation kit by CRISPRa
GA106297 1 Kit

Human CHST2 activation kit by CRISPRa

Sign In for Pricing
View Details