Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 43 (Tmem43)

This Recombinant Rat Transmembrane protein 43 (Tmem43) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Transmembrane protein 43, Protein LUMA

UniProt

Q5XIP9

Expression Region

2-400

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AANYSSTGSRKEHVKVTSDPQPGFLERLSETSGGMFVGLVTFLLSFYLIFTNEGRALKTA NLLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESNEYTEDGQVKKETKYSYNTEWRSEIVSSKNFDREIGHKNPSAMAVESFTAT APFVQIGRFFLSAGLIDKIDNFKPLSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVRV SFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQ KSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWAALLGCLALVPIIIARTRVPTKKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant MEK7 Antibody
RC-15257-01 50 μL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-15257-02 100 µL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
Recombinant MEK7 Antibody
RC-15257-03 1 mL

Recombinant MEK7 Antibody

Sign In for Pricing
View Details
EPO (NM_000799) Human Over-expression Lysate
LC400277 20 µg

EPO (NM_000799) Human Over-expression Lysate

Sign In for Pricing
View Details
Usp11 Mouse Gene Knockout Kit (CRISPR)
KN518766 1 Kit

Usp11 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human Lambda Light Chain (LcN-2 + ICO-106), CF594 conjugate, 0.1mg/mL
BNC940735-100 1x 100 µL

Human Lambda Light Chain (LcN-2 + ICO-106), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details