Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Transmembrane protein 43 (Tmem43)

This Recombinant Rat Transmembrane protein 43 (Tmem43) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Transmembrane protein 43, Protein LUMA

UniProt

Q5XIP9

Expression Region

2-400

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AANYSSTGSRKEHVKVTSDPQPGFLERLSETSGGMFVGLVTFLLSFYLIFTNEGRALKTA NLLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESNEYTEDGQVKKETKYSYNTEWRSEIVSSKNFDREIGHKNPSAMAVESFTAT APFVQIGRFFLSAGLIDKIDNFKPLSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVRV SFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQ KSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWAALLGCLALVPIIIARTRVPTKKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human GOT1L1 activation kit by CRISPRa
GA115280 1 Kit

Human GOT1L1 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS620197 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details
TBC1D24 (NM_020705) Human Recombinant Protein
TP310346L 1 mg

TBC1D24 (NM_020705) Human Recombinant Protein

Sign In for Pricing
View Details
MTHFR Mouse Monoclonal Antibody [Clone ID: OTI2B4]
CF812671 100 µg

MTHFR Mouse Monoclonal Antibody [Clone ID: OTI2B4]

Sign In for Pricing
View Details
GI24 (C10orf54) (NM_022153) Human Recombinant Protein
TP304547 20 µg

GI24 (C10orf54) (NM_022153) Human Recombinant Protein

Sign In for Pricing
View Details
Frozen Tissue Blocks, Breast
CB531800 1 Block

Frozen Tissue Blocks, Breast

Sign In for Pricing
View Details