Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 43 (Tmem43)

This Recombinant Mouse Transmembrane protein 43 (Tmem43) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Transmembrane protein 43, Protein LUMA

UniProt

Q9DBS1

Expression Region

2-400

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AANYSSTSSRKEHVKVTSEPQPGFLERLSETSGGMFVGLMTFLLSFYLIFTNEGRALKTA TSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESSEYTEDGQVKKETKYSYNTEWRSEIVNSRNFDREIGHKNPSAMAVESFTAT APFVQIGRFFLSAGLIDKIDNFKALSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVRV SFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQ KSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWAALIGCLALVPIIIARTRVPAKKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ARF3 (NM_001659) Human Recombinant Protein
PH39011M5 20 µg

ARF3 (NM_001659) Human Recombinant Protein

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (MaxLight 550)
MBS6456961-01 0.1 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (MaxLight 550)

Sign In for Pricing
View Details
LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (MaxLight 550)
MBS6456961-02 5x 0.1 mL

LIPI (Lipase Member I, LIPI, 311-, Cancer/Testis antigen 17, CT17, LPD Lipase, Membrane-Associated Phosphatidic Acid-Selective PhosphoLipase A1-beta, mPA-PLA1 beta, LIPI, LPDL) (MaxLight 550)

Sign In for Pricing
View Details
BioWave Violet 450 Anti-Mouse CD45.1 (A20)
orb1214983-01 25 µg

BioWave Violet 450 Anti-Mouse CD45.1 (A20)

Sign In for Pricing
View Details
BioWave Violet 450 Anti-Mouse CD45.1 (A20)
orb1214983-02 100 µg

BioWave Violet 450 Anti-Mouse CD45.1 (A20)

Sign In for Pricing
View Details
Human CXC-chemokine receptor 3,CXCR3 ELISA KIT
JOT-EK0255Hu-01 96 Well

Human CXC-chemokine receptor 3,CXCR3 ELISA KIT

Sign In for Pricing
View Details