Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 43 (Tmem43)

This Recombinant Mouse Transmembrane protein 43 (Tmem43) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Transmembrane protein 43, Protein LUMA

UniProt

Q9DBS1

Expression Region

2-400

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AANYSSTSSRKEHVKVTSEPQPGFLERLSETSGGMFVGLMTFLLSFYLIFTNEGRALKTA TSLAEGLSLVVSPDSIHSVAPENEGRLVHIIGALRTSKLLSDPNYGVHLPAVKLRRHVEM YQWVETEESSEYTEDGQVKKETKYSYNTEWRSEIVNSRNFDREIGHKNPSAMAVESFTAT APFVQIGRFFLSAGLIDKIDNFKALSLAKLEDPHVDIIRRGDFFYHSENPKYPEVGDVRV SFSYAGLSSDDPDLGPAHVVTVIARQRGDQLIPYSTKSGDTLLLLHHGDFSAEEVFRREQ KSNSMKTWGLRAAGWMAMFMGLNLMTRILYTLVDWFPVFRDLVNIGLKAFAFCVATSLTL LTVAAGWLFYRPLWAALIGCLALVPIIIARTRVPAKKLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein L1 Recombinant Protein Antigen
NBP1-89033PEP 0.1 mL

Apolipoprotein L1 Recombinant Protein Antigen

Sign In for Pricing
View Details
CYGB CRISPRa sgRNA lentivector (set of three targets)(Human)
17300121 3x 1.0µg DNA

CYGB CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
KRT18P42 3'UTR GFP Stable Cell Line
TU062042 1.0 mL

KRT18P42 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Campylobacter Fetus rpsR Protein (aa 1-86)
VAng-Lsx6159-500gEcoli 500 µg (E. coli)

Recombinant Campylobacter Fetus rpsR Protein (aa 1-86)

Sign In for Pricing
View Details
CD223/LAG3 Human Monoclonal Antibody (PE)
orb2970950-01 50 Tests

CD223/LAG3 Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details
CD223/LAG3 Human Monoclonal Antibody (PE)
orb2970950-02 100 Tests

CD223/LAG3 Human Monoclonal Antibody (PE)

Sign In for Pricing
View Details