Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype A3 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype A3 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q4R1S6

Expression Region

2-400

Origin

Hepatitis B virus genotype A3 (isolate Cameroon/CMR983/1994) (HBV-A)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWLPKPRKGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPIKDHWPQANQVGVG AFGPGFTPPHGGVLGWSPQAQGTLTTVPAVPPPASANRQSGRQPTPISPPLRDSHPQAIK WNSPAFHQALQDPRVKGLYFPAGGSSSGTVSPVPNIASHISSISSRTGDPAPTMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLGQNSQSPTSNHSPTSCPP ICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTP AQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPRLYNILSPFIPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Lysozyme/LYZ Antibody Picoband® (Biotine Conjugate)
A01811-1-Biotin 100 µg/Vial

Anti-Lysozyme/LYZ Antibody Picoband® (Biotine Conjugate)

Sign In for Pricing
View Details
Lrrk1 3'UTR GFP Stable Cell Line
TU162655 1.0 mL

Lrrk1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Tnfrsf21 Mouse qPCR Primer Pair (NM_178589)
MP217762 200 Reactions

Tnfrsf21 Mouse qPCR Primer Pair (NM_178589)

Sign In for Pricing
View Details
Actl9b 3'UTR Lenti-reporter-Luc Vector
11265086 1.0 µg

Actl9b 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Olfr583 Protein Vector (Mouse) (pPM-C-HA)
33276024 500 ng

Olfr583 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ILDR1 Antibody
A59328-100UL 100 µL

ILDR1 Antibody

Sign In for Pricing
View Details