Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ayr Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ayr Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q76R62

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ayr (isolate Human/Japan/Okamoto/-) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEANQVGAG AFGPGFTPPHGGLLGWSPQAQGILTTLPAAPPPASTNRQSGRQPTPISPPLRDSHPQAMQ WNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPNMESTTSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPGQNSQSPTSNHSPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGTSTTSTGPCRTCTIP AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSAIWMMWYWGPSLYNILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KDELC2 Recombinant Protein (Rat)
RP207020 100 µg

KDELC2 Recombinant Protein (Rat)

Sign In for Pricing
View Details
20S Proteasome alpha 6 antibody
23059 100 µL

20S Proteasome alpha 6 antibody

Sign In for Pricing
View Details
SRP9 Protein Vector (Human) (pPB-N-His)
PV040130 500 ng

SRP9 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Samd4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
42997065 1.0 µg DNA

Samd4 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Rubisco (Large Chain) Mouse mAb (6F3)
MBS8539896-01 0.1 mL

Rubisco (Large Chain) Mouse mAb (6F3)

Sign In for Pricing
View Details
Rubisco (Large Chain) Mouse mAb (6F3)
MBS8539896-02 0.1 mL (AF405L)

Rubisco (Large Chain) Mouse mAb (6F3)

Sign In for Pricing
View Details