Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JN07

Expression Region

2-400

Origin

Hepatitis B virus genotype H subtype adw4 (isolate Nicaragua/1853Nic/1997) (HBV-H)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVG GFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTGDPAMNMENITSG LLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL
BNC941930-100 1x 100 µL

PAX5 / BSAP (Early B-Cell Marker) (PCRP-PAX5-1B1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human b-Lipoprotein,  20nm
GM-506-20 1 mL

Colloidal Gold Conjugated Goat Affinity Purified Antibody to Human b-Lipoprotein, 20nm

Sign In for Pricing
View Details
2,6-Di-tert-butyl-p-cresol
TRC-D429480-1G 1 g

2,6-Di-tert-butyl-p-cresol

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-01 20 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-02 60 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details
RHEB Polyclonal Antibody
E-AB-16645-03 120 µL

RHEB Polyclonal Antibody

Sign In for Pricing
View Details