Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JN07

Expression Region

2-400

Origin

Hepatitis B virus genotype H subtype adw4 (isolate Nicaragua/1853Nic/1997) (HBV-H)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVG GFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTGDPAMNMENITSG LLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCNB1IP1 Human qPCR Primer Pair (NM_182851)
HP226373 200 Reactions

CCNB1IP1 Human qPCR Primer Pair (NM_182851)

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB510316 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
Recombinant Human THEM2/ACOT13 Protein (His Tag)
PKSH032042-01 10 µg

Recombinant Human THEM2/ACOT13 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human THEM2/ACOT13 Protein (His Tag)
PKSH032042-02 50 µg

Recombinant Human THEM2/ACOT13 Protein (His Tag)

Sign In for Pricing
View Details
Synaptotagmin 3 (SYT3) (NM_001160328) Human Recombinant Protein
TP328969M 100 µg

Synaptotagmin 3 (SYT3) (NM_001160328) Human Recombinant Protein

Sign In for Pricing
View Details
KIR3DL1 Antibody
KC-923-01 50 μL

KIR3DL1 Antibody

Sign In for Pricing
View Details