Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype H subtype adw4 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JN07

Expression Region

2-400

Origin

Hepatitis B virus genotype H subtype adw4 (isolate Nicaragua/1853Nic/1997) (HBV-H)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVG GFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRGLYFPAGGSSSETQNPVPTIASLTSSIFSKTGDPAMNMENITSG LLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cal-630™ AM
20530-AAT 5x 50 µg

Cal-630™ AM

Sign In for Pricing
View Details
Adenylate Kinase 1 (AK1) (N-term) Rabbit Polyclonal Antibody
AP15162PU-N 400 µL

Adenylate Kinase 1 (AK1) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC284912 Human Gene Knockout Kit (CRISPR)
KN400986 1 Kit

LOC284912 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TMEM214 activation kit by CRISPRa
GA110325 1 Kit

Human TMEM214 activation kit by CRISPRa

Sign In for Pricing
View Details
MEK3 (MAP2K3) Human qPCR Primer Pair (NM_145109)
HP234759 200 Reactions

MEK3 (MAP2K3) Human qPCR Primer Pair (NM_145109)

Sign In for Pricing
View Details
Desmocollin 3 (DSC3) (C-term) Rabbit Polyclonal Antibody
AP51323PU-N 400 µL

Desmocollin 3 (DSC3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details