Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B1 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B1 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JXB9

Expression Region

2-400

Origin

Hepatitis B virus genotype B1 (isolate Japan/Ry30/2002) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVG AFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQ WNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASG LLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPP ICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTP AQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE (C-term) Rabbit pAb
E2616441 100 µL

ACE (C-term) Rabbit pAb

Sign In for Pricing
View Details
MIRHG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1304308 1.0 µg DNA

MIRHG1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
SRR (Biotin)
577830-01 50 µg

SRR (Biotin)

Sign In for Pricing
View Details
SRR (Biotin)
577830-02 100 µg

SRR (Biotin)

Sign In for Pricing
View Details
SMC2 Conjugated Antibody
C43911 100 µL

SMC2 Conjugated Antibody

Sign In for Pricing
View Details
FUNDC2P1 Adenovirus (Human)
21067051 1.0 mL

FUNDC2P1 Adenovirus (Human)

Sign In for Pricing
View Details