Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype B1 Large envelope protein (S)

This Recombinant Hepatitis B virus genotype B1 Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JXB9

Expression Region

2-400

Origin

Hepatitis B virus genotype B1 (isolate Japan/Ry30/2002) (HBV-B)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRKGMGTNLSVPNPLGFFPDHQLDPAFKANSENPDWDLNPHKDNWPDAHKVGVG AFGPGFTPPHGGLLGWSPQAQGILTSVPAAPPPASTNRQSGRQPTPLSPPLRDTHPQAMQ WNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSTTGDPVPNMENIASG LLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTPVCLGQNSQSPISSHSPTCCPP ICPGYRWMYLRRFIIXLCILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCKTCTTP AQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYNILSPFMPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gtf2a2 (NM_001039519) Mouse Tagged ORF Clone Lentiviral Particle
MR217006L3V 200 µL

Gtf2a2 (NM_001039519) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AMPK alpha 1 monoclonal antibody
orb1495621-01 50 μL

AMPK alpha 1 monoclonal antibody

Sign In for Pricing
View Details
AMPK alpha 1 monoclonal antibody
orb1495621-02 100 µL

AMPK alpha 1 monoclonal antibody

Sign In for Pricing
View Details
AMPK alpha 1 monoclonal antibody
orb1495621-03 200 µL

AMPK alpha 1 monoclonal antibody

Sign In for Pricing
View Details
Evernic acid
BUP23169 1 mg

Evernic acid

Sign In for Pricing
View Details
Lentiviral human WRAP73 shRNA (UAS) - Lentiviral human WRAP73 shRNA (UAS, RFP) plasmid
GTR15154645 1 Vial

Lentiviral human WRAP73 shRNA (UAS) - Lentiviral human WRAP73 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details