Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype H Large envelope protein (S)

This Recombinant Hepatitis B virus genotype H Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JMY6

Expression Region

2-400

Origin

Hepatitis B virus genotype H (isolate United States/LAS2523/2002) (HBV-H)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVG GFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSG LLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), Biotin conjugate, 0.1mg/mL
BNCB1779-100 1x 100 µL

CD8A (Cytotoxic- & Suppressor T-Cell Marker) (C8/1779R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CO2 Incubator Air Jacketed BCAJ-6805
BCAJ-6805 1 Unit

CO2 Incubator Air Jacketed BCAJ-6805

Sign In for Pricing
View Details
4-Dodecanolide
TRC-D525393-5G 5 g

4-Dodecanolide

Sign In for Pricing
View Details
Uncoated Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-UNEL-H0351-01 5x 96 Tests

Uncoated Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit
E-UNEL-H0351-02 15x 96 Tests

Uncoated Human VEGFR-2/KDR (Vascular Endothelial Growth Factor Receptor 2) ELISA Kit

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR560546 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details