Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype H Large envelope protein (S)

This Recombinant Hepatitis B virus genotype H Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q8JMY6

Expression Region

2-400

Origin

Hepatitis B virus genotype H (isolate United States/LAS2523/2002) (HBV-H)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GAPLSTARRGMGQNLSVPNPLGFFPDHQLDPLFRANSSSPDWDFNTNKDNWPMANKVGVG GFGPGFTPPHGGLLGWSPQAQGILTTSPPDPPPASTNRRSGRKPTPVSPPLRDTHPQAMQ WNSTQFHQALLDPRVRGLYFPAGGSSSETQNPAPTIASLTSSIFSKTGDPAMNMENITSG LLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTL AQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLS PTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAPPC3L (NM_001139444) Human Over-expression Lysate
LY427960 100 µg

TRAPPC3L (NM_001139444) Human Over-expression Lysate

Sign In for Pricing
View Details
KRT23 Mouse Monoclonal Antibody [Clone ID: AT2F6]
AM50010PU-S 50 µL

KRT23 Mouse Monoclonal Antibody [Clone ID: AT2F6]

Sign In for Pricing
View Details
Frozen Tissue Sections, Cecum
CS506128 5x 5 µm

Frozen Tissue Sections, Cecum

Sign In for Pricing
View Details
HE4 Recombinant Rabbit monoclonal Antibody
HA750355 100 µL

HE4 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
MRPS33 Antibody
8C16661-AAT 50 µg

MRPS33 Antibody

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse IL-17A Antibody[17F3]
E-AB-F1272UH-01 25 µg

PE/Cyanine7 Anti-Mouse IL-17A Antibody[17F3]

Sign In for Pricing
View Details