Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S)

This Recombinant Hepatitis B virus genotype C subtype ayw Large envelope protein (S) spans the amino acid sequence from region 2-400.

Product Specifications

Product Name Alternative

Large envelope protein, L glycoprotein, L-HBsAg, LHB, Large S protein, Large surface protein, Major surface antigen

UniProt

Q913A6

Expression Region

2-400

Origin

Hepatitis B virus genotype C subtype ayw (isolate China/Tibet127/2002) (HBV-C)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GGWSSKPRQGMGTNLSVPNPLGFFPDHHLDPAFGANSNNPDWDFNPNKDHWPKANQVRAG AFGPGFTPPHCSLLGWSPQAQGILTTVPAAPPPASSNRQSGKQPTPISPPLRDSHPQAMQ WNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIGDPALNMENITSG FLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPISNHSPTSCPP TCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTP AQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLS PTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6C3 Human Gene Knockout Kit (CRISPR)
KN424404 1 Kit

OR6C3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone
CS711509 5x 5 µm

Tissue FFPE Sections, Bone

Sign In for Pricing
View Details
SLC1A4 (NM_003038) Human Over-expression Lysate
LY418935 100 µg

SLC1A4 (NM_003038) Human Over-expression Lysate

Sign In for Pricing
View Details
KIAA0513 Polyclonal Antibody
E-AB-90918-01 60 µL

KIAA0513 Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0513 Polyclonal Antibody
E-AB-90918-02 120 µL

KIAA0513 Polyclonal Antibody

Sign In for Pricing
View Details
KIAA0513 Polyclonal Antibody
E-AB-90918-03 200 µL

KIAA0513 Polyclonal Antibody

Sign In for Pricing
View Details